Skip to content

Elliot-Chan-120/NanoMaker

Repository files navigation

NanoMaker

NanoMaker takes a drug molecule as input and designs a high-affinity protein binding pocket / surface patch around its geometric center using both spatial and biochemical data.


A personal research prototype, NanoMaker is a dual cross-attention transformer system that generates a 3D arrangement of amino acid (AA) residues' alpha carbons that would form a high-affinity binding area to any given chemical's scaffold in SMILES format. These can then be used as protein binding pocket templates for drug-delivery molecules. NanoMaker also comes with a visualization and characterization module, allowing for downstream analyses.

NanoMaker separates the challenge of de novo protein design into two cross-attention transformer tasks. Model 1, Skeleton, creates the 3D spatial arrangement / skeleton of the upcoming protein pocket, while model 2, NAAnoBot, slots amino acids (AAs) into the empty coordinates based on biochemical and spatial compatibility. Both transformers are cross-attention models conditioned on drug structure, meaning that each protein pocket is specific to the given drug's properties.

I've drawn out a conceptual example skeleton and its populated final form, we will see what they look like in practice further down:

Figure 1: 3D arrangement / "skeleton" Figure 2: Full NanoMaker-generated pocket
skeleton_product.png NanoMaker_product.png

On the left we see a system of linked empty nodes representing AA slots forming a pocket around the ligand centroid (drug geometric center). In the drawing on the right I've filled in those nodes with amino acid identities, completing the protein binding pocket.

You can interact with some protein pockets I've made on my own through my portfolio website: CLICK ME!

Notes:

  • "Ligand" and "drug" will be used interchangeably. A ligand is just something that binds. In this case it's a chemical structure.
  • Scaffold: core structure of a given drug
  • Analog(ue): variation of a scaffold

NanoMaking

Installation + start virtual environment

git clone https://github.com/Elliot-Chan-120/NanoMaker.git
cd NanoMaker
python3 -m venv .venv

Activate virtual environment

source .venv/bin/activate  <- Linux and Mac
.venv/Scripts/activate  <- Windows

Install requirements

pip install -r requirements.txt

I've created a separate repo where you can download the model weights: https://huggingface.co/ElliotChan120/NanoMakers

Or you can copy the database files and prototyping notebooks into a cloud server like colab or lightningai (i prefer that one) to train with your own parameters. I used a T4 GPU on LightningAI, but if you have a good nvidia gpu and can afford a few days that's fine too. It took me over 48 hours to train both models.

Once you have the model weights, move them here, where the config.py file lives: src/nano_maker/container.

Test run for aspirin:

NanoMaker is runnable through both JupyterLab and the CLI, whose commands are covered below. I've also included a "nanomaker_use.ipynb" file that guides the user through a typical run. This section covers what a typical run should resemble when executing all cells in the guide file or all cli commands:

Aspirin's chemical smiles is: "CC(=O)OC1=CC=CC=C1C(=O)O".

First, NanoMaker will produce a ".nanopkt" file in this specific format that downstream modules can parse, visualize and characterize.

The cli command for this is:

(from root)
python3 nnmkr.py generate "CC(=O)OC1=CC=CC=C1C(=O)O" aspirin --temp 0.3
                          # smiles needs parentheses         # sampling_temperature: 
                                                               - how "strict" the amino acid choices are
                                                               - 0.3 by default
                                                               - lower = stricter and vice versa

aspirin.nanopkt file:

>_0.3_ms7e84_c1ccccc1
Target>_CC(=O)OC1=CC=CC=C1C(=O)O

>__nnpkt
E	[0.173, -15.92, -0.0297]
E	[8.2984, -12.871, 1.6654]
H	[-2.1276, -14.4948, 3.5951]
C	[0.2286, -14.481, 2.6729]
S	[0.3466, -14.3896, 1.8595]

... I've pruned the data to save space

I	[0.1374, 0.021, 1.1619]

The analysis module allows for various types of visualization depending on each amino acid's properties. Here I have visualized the pocket by each amino acid's [1] raw skeleton, [2] polar_character, and [3] steric_accessibility (size and exposed surface vol.). The other options are: amino acid identity, hydrophobicity, and flexibility. The visualizations are done via plotly express, so in the notebook or window you can drag, zoom, and hover over each node to see its identity and analysis values.

cli command:

python3 nnmkr.py visualize aspirin [insert visualization mode here] --save <- if you want to save it as html, leave blank if not needed
Visualization type Image
skeleton aspirin_skeleton.png
polar_character aspirin_polarchar.png
steric_accessibility aspirin_stericaccess.png

NanoMaker's pocket analysis module allows for quantitative analysis of the binding pockets produced, as visual analysis might not be concrete enough. I've also included a "note-taking" function that records any notable standout features the binding pocket produced may exhibit.

cli command:

python3 nnmkr.py report aspirin --save
BINDING POCKET REPORT
==================================================
Sampling temperature: 0.3
Amino acid sequence:EEHCSRLRCGAISCVDTKKLAIIIGTNAQSHYKCANSPQVGQIIAGFDEHI
==================================================

Section 1: Biochemical Property Summary
|-- average_polar_character: 0.209
|-- polar_character_deviation_pct: 13.396
|-- average_hydrophobicity: 0.202

....

Section 2: Geometric Analysis
|-- X range: 19.767
|-- Y range: 17.981
|-- Z range: 8.065

==================================================

Notable Binding Pocket Characteristics:
- slightly polar character, slightly hydrophilic, chamber-style binding pocket

Note that aspirin does have polar and hydrophilic character so the characteristics line up nice. See "Performance and Model Behaviour" for a more complete picture of how these models behave during generation.

With that we've successfully generated, visualized and analyzed a protein binding pocket for Aspirin!


Transforming the Protein Space

Transformers are sequence models famously known for operating on tokens within natural language processing... but protein binding pockets are not sentences to be translated, they're 3D structures with each node representing a unique biochemical environment. NanoMaker employs a unique method to convert these 3D biochemical environments into a sequential representation Skeleton and NAAnoBot can learn from.

(Inverse) Radial Sequencing

I imagined the space around an arbitrary drug centroid as a series of spherical shells, with each sequential shell's radius increasing. Think of a glass ball within a glass ball many times over, with the outermost glass ball being the largest and vice versa. I've characterized 3D protein binding pockets as "radial" sequences of AA identities and their spherical coordinates ordered by decreasing shell radius. The fineness of the ordering is determined by a "radial_resolution" parameter (default 100, so 100 shells or glass balls). I've attempted to draw and visualize my conceptualization of this here:

Protein pocket to "radial_sequence" visualization

Resulting "radial sequences" are presented as such during training with the goal of autoregressively predicting the next set of vectors.

[[[AA identity 1], [rad1, az1, pl1]], [[AA identity 2], [rad2, az2, pl2]] .... [[VOID], [0, 0, 0]]]
              # radius, azimuth, polar                                            # end "token"

Coordinates consist of radius value in angstroms, azimuth and polar angles computed from relative XYZ values.

The choice to go outward -> inward was deliberate as I wanted the resulting transformers to have as much information as possible before placing amino acids within the closest proximity to the ligand, as intuitively these should be the most important AAs to stabilize / bind.

Sequencing Concept Logic: Imagine an observer object exploring the entire protein pocket space shell by shell, recording each subsequent amino acid's (decreasing) radius to the ligand centroid until the last amino acid's data is recorded. The very end of each sequence is padded with a "VOID" identity and a spherical coordinate of zeros, which conceptually is the "end" of the sequence as that's where the drug centroid is and a protein absolutely cannot exist there. Since protein pocket generation is out --> in, I interpreted hitting a radius of 0 and under as the equivalent to encountering an "END" token in Natural Language Processing.

Each amino acid identity is then mapped to its hand-curated unique biochemical feature vector downstream. These biochemical feature vectors are my attempt to represent amino acids by their physical and bio/chemical properties like isoelectric points, aromatic ring presence or hydrophobicity.


Skeleton: 3D structure generation

Model: Skeleton is responsible for generating the 3D spatial arrangement of the protein pocket prior to amino acid insertion into said pocket, hence the name "Skeleton".

When presented with a chemical compound, it will say: "the protein pocket surrounding this molecule should look like this". It then generates a series of spherical coordinate vectors, with each corresponding to a "blank" amino acid's alpha carbon placement relative to the drug compound's centroid (Figure 1).

note: alpha carbon = main carbon of amino acid

e.g.

alpha carbon 1: [14.13, -1.043, 1.56]
alpha carbon 2: [14.00, -1.95, 1.40]
alpha carbon 3: [13.8, -2.44, 1.53]
...
alpha carbon n+1: [radius =< threshold, azimuth, polar] <-- cutoff coordinate (radius below threshold)

These will then be translated back into finalized xyz coordinates.

alpha carbon 1: [-6.734169765180114, 14.448926127937195, 2.925794734487335],
alpha carbon 2: [-4.016766858354317, 14.904996348343234, 1.74489712118305],
alpha carbon 3: [-11.065344000905538, 9.318996844158944, 2.551681796821662],
...
alpha carbon n: [13.383470121049884, 4.287071199307037, -0.5404584759555853],

NAAnoBot: Biochemical Environment Curation

Model: NAAnoBot is responsible for deciding which amino acid belongs in a given coordinate.

Each AA is characterized by their physicochemical properties and (bio)chemical makeup that distinguish them from the rest. NAAnoBot works with spatially aware "tokens", meaning it actually doesn't interpret sequences via amino acid identities (like "A", "H", "C" etc.) but rather their feature vectors and relative geometries. Its selection of the next AA depends on the neighbouring AAs biochemistry and their spatial positioning relative to the target coordinate.

(In human terms...) NAAnoBot doesn't say "Valine" or "Leucine" belongs here, instead it says:

"I see all these AAs around target coordinate 'x', and because of their biochemical features and geometry relative to 'x', an amino acid with these biochemical properties would fit in there".

Once the biochemical feature vector is produced, it is then matched against all amino acid feature vectors to determine its best fit. It does this continuously for each provided coordinate until the protein pocket is completed.

For more information on how each amino acid is characterized biochemically, the source file "naanolibrary.py" in src/nano_maker/modules/nAAno contains the sources + citations and some comments further clarifying the feature engineering scheme.


Data + Training

Data is resolved protein-drug complexes from BindingDB and PDB with binding affinities of 0.1nM (extremely high affinity). Skeleton's loss was defined as a composite across MSE of radius and unit circle angle difference, with weighted emphasis on angular orientation. NAAnoBot's loss is a composite of cross entropy and weighted similarity between predicted feature vectors and the target AA's feature vector (nAAno_token!). The data split was done according to drug scaffold identity rather than a random split after combinatorial explosion of drug vs. sequence windows.

Total SMILES were split 80% into training and 20% into validation prior to sequence window extraction. Training split comprised of ~7 million training sequence windows. Validation set was comprised solely of molecule scaffolds non-existent in training data, meaning that the models' performance relies on whether they learnt actual relationships b/w 3D arrangement, biochemistry and drug structure rather than memorization.

See Disclaimer at the bottom regarding novel chemistry generalization ability and justification for using scaffolds instead of absolute drug analogues.


Loss Metrics

Skeleton and NAAnoBot went through the same train / validation drug scaffold identity split. Training loss was computed as a running average over all batches, hence why the initial epoch gaps are large.

Skeleton Loss:

0.1 * radial loss + 0.45 * azimuth loss + 0.45 * polar loss
Epoch Train (3sf) Validation (3sf) Gap (3sf)
Initial 11.380 n/a n/a
1 0.912 0.762 -0.150
2 0.780 0.620 -0.160
3 0.646 0.482 -0.165
4 0.523 0.370 -0.153
5 0.443 0.317 -0.126

note: I do intend to train skeleton for 8 epochs total eventually, but I ran out of hours on lightningai and I already spent 50 bucks on extra credits. Regardless, it's become apparent that Loss matters less than output sanity when it comes to evaluating how "good" each of these models is.

NAAnoBot Loss:

0.8 * Cross Entropy b/w predicted vectors and AA vectors + 0.2 * vector similarity loss
Epoch Train (3sf) Validation (3sf) Gap (3sf)
Initial 2.874 n/a n/a
1 1.438 1.156 -0.28
2 1.162 1.109 -0.0537
3 1.131 1.0986 -0.0326
4 1.120 1.0946 -0.0249
5 1.114 1.0937 -0.0205

Performance and Model Behaviour Observations

Since truly examining NAAnoBot's biochemical reasoning ability would require extensive analyses, I decided to plot average protein pocket polar character over 10 generated pockets vs. 10 drug logP (hydrophobicity / polarity inferred) values as a proxy for its potential biochemical reasoning ability. Sampling temperature was set to 0.05 (basically argmax) for maximum strictness and no variation. Pockets produced were definitely not natural but were representative of NAAnoBot's behaviour. Polar character is an aggregate across net charge, hydrophobicity, # of H donors and H acceptors.

This is a preliminary test and should not be interpreted as validation of binding-pocket realism.

Compound Name Scaffold LogP Protein Pocket Polar_character x10 (readability)
methotrexate 2.0319 3.8410
caffeine -1.0605 0.5391
ciprofloxacin 1.746 2.7745
benzene 1.687 1.3470
diazepam 2.476 4.0941
cyclosporin A -9.722 2.4520
testosterone 4.128 3.4497
paclitaxel 6.0356 1.2955
atorvastatin 5.601 4.8161
cholesterol 4.949 5.1344

R^2 = 0.116

R^2 excluding cyclosporin and paclitaxel: 0.755 (Explanation for this metric below)

Benchmark Graph: Compound LogP vs Protein Polar Character * 10

The graph above shows two roughly drawn correlation lines which I'll explain.

Using scaffold-level LogP rather than absolute identity LogP, correlation (green line) across all 10 compounds was very weak with an R^2 of 0.116. Visually and after consulting the table, it's clear that this is almost entirely driven by cyclosporin and paclitaxel, which have two of the most extreme scaffold LogPs of (roughly) -9.8 and 6 out of the entire dataset (smallest and largest). Furthermore, on a biochemical level these two are large and highly complex, one being a macrocycle and the other having a fused tetracyclic core (human terms: massive ring, and 4 fused rings). Those two outlier molecules are exactly within the category flagged in the Disclaimer section as poorly generalized under scaffold-level data splitting.

When correlation analysis was done on the non-outlier set (light blue line) consisting mainly of more compact molecules' scaffolds, correlation shot up to 0.755 (strong correlation).

Although the sample and testing are both too small and too simplistic to treat as conclusive, this suggests that NanoMaker's biochemical reasoning may be more reliable for smaller, scaffold-representative molecules than for larger macromolecules whose core scaffolds don't capture extensive binding-relevant features. Furthermore, other small drugs that were planning on being tested like urea had empty scaffolds where the scaffold would literally be "". So it's impossible to tell how well NAAnoBot would generalize to such molecules who literally don't have scaffolds.

Observationally, it appears there is a link between Skeleton's choices in protein cage design. Throughout the process of making NanoMaker, I noticed that pocket styles varied across different molecules. I characterized them into 4 types named after the shapes they roughly tend to adopt. note: all generation is happening in 33x33x33 Angstrom space.

Surface Patch Claw
Flat shape, does not cover any dimension significantly. Shallow pocket, resembles an outstretched claw.
Side view, amino acid color code Side view, hydrophobicity color code
Vice Chamber
Resembles a partially enclosed vice or hand 3D coverage, forms a chamber-like pocket
Top-down view, polar character color code Top-down view, flexibility color code

All pockets I've ever generated stuck to one hemisphere of the centroid, whether or not this reflects the actual biochemistry is out of my depth...

With some pockets you might have to play around with the perspective (and your imagination) to see the shapes mentioned.

Overall, this project demonstrates that the architecture can generate structurally varied protein binding pockets whose aggregated biochemical properties appear to vary with the ligand scaffold's features. Further validation would be needed to confirm if amino acid selection patterns are truly biochemically reasoned within NAAnoBot, as of right now it remains an open question.


Disclaimer + Limitations, Notes on Using Scaffolds and Pathogenic Resemblance

NanoMaker is purely an independent research prototype, built for learning and exploration. Generated protein pockets do not account for orientation of both the ligand or the amino acids themselves in 3D space. The architecture, training pipeline and data representations are not validated against established benchmarks in structural biology or computational drug discovery. Generated pockets should not be used to inform any protein design, clinical or therapeutic decisions.

True zero-shot capability on novel chemistry would require further validation


Using Scaffolds instead of Absolute Drug Identity

The original prototype of NanoMaker separated train-test data by absolute drug identity rather than the scaffold identity. The problem is, for drug-protein pairs with high-affinity binding of 0.1nM, many chemical compounds were highly similar analogs. This led to many compounds with the same scaffold but with 10-80+ analogues within each train-test split, introducing a high degree of data homogeneity and a slight possibility of minimal data leakage (1 cluster of drug analogs split across the train / test).

NanoMaker was essentially being trained, then tested on chemically homogeneous data. Which is not optimal at all for zero-shot capability on novel chemistry, one of the main goals of this project.

All chemical compounds were then split by their scaffolds, removing analogs and looking at their core chemistry and structure instead. Chemically similar scaffolds still persisted but the 50% reduction achieved by this splitting style is a clear indicator of analogue redundancy being addressed. Any data leakage from this was likely minimal given the reduced size of potential clusters, but validation metrics should still be considered slightly optimistic.

Furthermore, splitting by scaffold means that during inference, molecules whose R groups contribute greatly to binding dynamics are not well-generalized, and binding pockets generated for these "R group-dependent" molecules should be treated as scaffold-level rather than R-group-specific generations.


Note on Pathogenic Resemblance

There may also exist the possibility that the pockets generated might resemble certain pathogenic molecules since that's what the training data comprised of. However, I should note that there is a distinction between:

  • Pathogenic active / binding sites: exist within a pathogen + performs harmful function, comprised of more complex structures
  • NanoMaker-generated pockets: 3D-designed binding pocket with the sole purpose of high binding affinity

License

Copyright (c) 2026 Elliot Chan

This project is licensed under the GNU Affero General Public License v3.0. See the LICENSE file for details.

About

NanoMaker is a dual cross-attention transformer system that generates 3D protein binding pockets around any drug scaffold's geometric center.

Topics

Resources

License

Stars

0 stars

Watchers

0 watching

Forks

Releases

No releases published

Packages

 
 
 

Contributors